PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g20300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family YABBY
Protein Properties Length: 91aa    MW: 10083.8 Da    PI: 10.1319
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g20300.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY34.85.8e-1120522961
            YABBY 29 tslfkvvtvrCGhCtsllsvnlakasqllaaes 61
                      slf +vtvrCGhCt+l svn+a a q l+ ++
  Vradi07g20300.1 20 RSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQD 52
                     69*********************9999888766 PP

2YABBY271.3e-087490118134
            YABBY 118 PPekrqrvPsaynrfik 134
                       PekrqrvPsayn+fik
  Vradi07g20300.1  74 APEKRQRVPSAYNQFIK 90 
                      69**************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046906.5E-102052IPR006780YABBY protein
PfamPF046903.5E-67290IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MLRPSNSVTS PATFAILFLR SLFDIVTVRC GHCTNLWSVN MAAAFQSLSW QDVQVRVGFV  60
GVIPFDKIEA PLVAPEKRQR VPSAYNQFIK *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150346e-54AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002527201.14e-25PREDICTED: axial regulator YABBY 5
SwissprotQ8GW462e-21YAB5_ARATH; Axial regulator YABBY 5
TrEMBLB9SMI24e-25B9SMI2_RICCO; Axial regulator YABBY5, putative
STRINGGLYMA13G22620.19e-24(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.21e-22YABBY family protein